PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00004355001
Common NameGSBRNA2T00004355001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ZF-HD
Protein Properties Length: 258aa    MW: 29515.8 Da    PI: 9.2399
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00004355001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.16.8e-3180135258
          ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                          ++v Y+eC++NhAas Ggh+vDGCgEfm+s geegta++l CaAC+CHR+FHR+e +
  GSBRNA2T00004355001  80 RRVSYRECQRNHAASSGGHVVDGCGEFMSS-GEEGTAESLLCAACDCHRSFHRKEFN 135
                          5799*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-2968137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.1E-2982133IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.66384133IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.8E-2984133IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466898.22E-18186254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-28187255IPR009057Homeodomain-like
TIGRFAMsTIGR015652.7E-28193250IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEVREKKDDK IEMERRQSSA NQNIQDHRLP PYTYSQTADK EKPTTKRNGS DPDPDLDTNP  60
TSIAPAPRSY ARPQTTSPTR RVSYRECQRN HAASSGGHVV DGCGEFMSSG EEGTAESLLC  120
AACDCHRSFH RKEFNSFGHS QRPLINRHVS PIMMSFGGGG GGRDPAESST EDLNRFHQAL  180
SGNGVDQFQY HPKKRFRTKF NQEQKERMFE FAEKIGWRMN KTEDEEVNRF CREINVKRQV  240
FKVWMHNNKQ AAKKKET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A2e-191932521776ZF-HD homeobox family protein
1wh7_A1e-191942491873ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.100440.0flower| microspore-derived embryo| seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325500.0AC232550.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH011J16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013695813.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-146ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A078JVS00.0A0A078JVS0_BRANA; BnaAnng34110D protein
STRINGBra037224.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-142homeobox protein 24
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]